Lysozyme navigation:        Home   |    Copyright   |    Contact us   |   
Lysozyme structure
Google
 
Lysozyme
  Enzyme
  Sequence
  Crystallization
  Structure
  Bibliography
  anti-HIV
  CCP4BB archive

Sequence of Lysozyme from different species

published: 10 Oct 2006 (21:04)
Lysozyme sequence was based on CLUSTALW multiple sequence alignment procedure (Thompson, J.D., Higgins, D.G. and Gibson, T.J. CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice (1994) Nucleic Acids Res., 22(22), 4673-4680.) to prepare sequence alignement for different Lysozyme sequences. Detailed analysis shows, that in this alignment all cysteine residues are conserved.

Chicken egg white Lysozyme sequence is colored red. Residues coloured blue - are completely conserved.

Part 1: 19 - 77:
LYSC_CHICK - KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNT-DGSTDYGILQIN
LYS1_MUSDO - KTFTRCSLAREMYALGVPKSE---LPQWTCIAEHESSYRTNVVGPTNSNGSNDYGIFQIN
LYSX_DROME - RTMDRCSLAREMANMGVSRDQ---LSKWACIAEHESSYRTGVVGPPNTDGSNDYGIFQIN
LYZL6_HUMAN - -LISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENA-DGSFDYGLFQIN
LYZL6_MOUSE - -IIHRCSLAKILYEEDLDGFEGYSLPDWLCLAFVESNFNISKVNENV-DGSFDYGIFQIN
LYZL4_HUMAN - -ILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPMAIYENTREGYTGFGLFQMR
LYZL4_MOUSE - -ILGRCTVAKMLYDGGLNYFEGYSLENWVCLAYFESKFNPSAVYEDPQDGSTGFGLFQIR
LYS_ANOGA - KTFGKCELAKALANNGIAK---ASLPDWVCLVQNESAFSTSATNKNK-NGSTDYGIFQIN
LYS_GALME - KTFTRCELVQALRRQGFDEAK---LRDWVCLVENESRGRTDIVGKPNKNGSRDYGLFQIN
LYS_BOMMO - KTFTRCGLVHELRKHGFEENL---MRNWVCLVEHESSRDTSKTNTNR-NGSKDYGLFQIN
LYS_HYACE - KRFTRCGLVQELRRLGFDE---TLMSNWVCLVENESGRFTDKIGKVNKNGSRDYGLFQIN
LYS_ANTMY - KRFTRCGLVNELRKQGFDENL---MRDWVCLVENESARYTDKIANVNKNGSRDYGLFQIN
LYS_HYPCU - ----RCDLVRELRKQGFPENQ---MGDWVCLVENESGRKTDKVGPVNKNGSKDYGLFQIN
LYS_TRINI - -----CELVHELRRQGFPEDK---MRDWVCLIQNESGRNTSKMGTINKNGSRDYGLFQIN
LYSC_COLLI - ----RCELVKILRRHGFEGFVGKTVANWVCLVKHESGYRTTAFNNNG-PNSRDYGIFQIN
LYSC_OPIHO - EIIPRCELVKILREHGFEGFEGTTIADWICLVQHESDYNTEAYNNN--GPSRDYGIFQIN
LYZL1_MOUSE - KIYTRCKLAKIFAKAGLDNYGGFALGNWLCMAYYESHYNTTAENVLE-DGSTDYGIFQIN
LYZL1_HUMAN - KIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLD-DGSIDYGIFQIN
LYZL2_HUMAN - KIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLD-DGSIDYGIFQIN
LYSC1_CANFA - KIFSKCELARKLKSMGMDGFHGYSLANWVCMAEYESNFNTQAFNGRNSNGSSDYGIFQLN
LYSC1_HORSE - KVFSKCELAHKLKAQEMDGFGGYSLANWVCMAEYESNFNTRAFNGKNANGSSDYGLFQLN
LYSC_EQUAS - KVFSKCELAHKLKAQEMDGFGGYSLANWVCMAEYESNFNTRAFNGKNANGSYDYGLFQLN
LYSC_TRISI - KIYEQCELAREFKRHGMDGYHGYSLGDWVCTAKHESNFNTAATNYNRGDQSTDYGILQIN
LYSC_CRAFA - KIYTRCELAAAMKRYGLDNYQGYSLGNWVCAARYESNYNTQATNRNS-DGSTDYGILQIN
LYSC_ORTVE - KIYKRCELAAAMKRYGLDNYRGYSLGNWVCAARYESNYNTQATNRNS-NGSTDYGILQIN
LYSC1_ANAPL - KVYSRCELAAAMKRLGLDNYRGYSLGNWVCAANYESGFNTQATNRNT-DGSTDYGILQIN
LYSC_AIXSP - KVYERCELAAAMKRLGLDNYRGYSLGNWVCAAKYESNFNTQATNRNT-DGSTDYGILEIN
LYSC3_ANAPL - KVYERCELAAAMKRLGLDNYRGYSLGNWVCAANYESSFNTQATNRNT-DGSTDYGILEIN
LYSC_PHACO - KVYGRCELAAAMKRMGLDNYRGYSLGNWVCAAKFESNFNTGATNRNT-DGSTDYGILQIN
LYSC_PHAVE - KVYGRCELAAAMKRMGLDNYRGYSLGNWVCAAKFESNFNTGATNRNT-DGSTDYGILQIN
LYSC_NUMME - KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNSQATNRNT-DGSTDYGVLQIN

LYSC_COTJA - KVYGRCELAAAMKRHGLDKYQGYSLGNWVCAAKFESNFNTQATNRNT-DGSTDYGILQIN
LYSC_SYRSO - KVYGRCELAAAMKRLGLDNFRGYSLGNWVCAAKFESNFNTHATNRNT-DGSTDYGILQIN

LYSC_COLVI - KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNSQATNRNT-DGSTDYGVLQIN
LYSC_LOPCA - KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNSQATNRNT-DGSTDYGVLQIN

LYSC_LOPLE - KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKYESNFNTHATNRNT-DGSTDYGILQIN
LYSC_CHRAM - KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHATNRNT-DGSTDYGILQIN

LYSC_SYRRE - KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHATNRNT-DGSTDYGILQIN
LYSC_MELGA - KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHATNRNT-DGSTDYGILQIN

LYSC_TRASA - KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHATNRNT-DGSTDYGILQIN
LYSC_TRATE - KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHATNRNT-DGSTDYGILQIN

LYSC_CATWA - KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHATNRNT-DGSTDYGILQIN
LYSC_PAVCR - KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKFESNFNTHATNRNT-DGSTDYGILQIN

LYSC_TRIVU - ----RCEFARRIKQLHLDGYHQISLANWVCLAQWESGFDTKATNYNPGDQSTDYGILQIN
LYSC_AXIAX - KVFERCELARTLKELGLDGYKGVSLANWLCLTKWESSYNTKATNYNPGSESTDYGIFQIN

LYSC1_BOVIN - KVFERCELARTLKKLGLDGYKGVSLANWLCLTKWESSYNTKATNYNPGSESTDYGIFQIN
LYSC3_BOVIN - KVFERCELARTLKKLGLDGYKGVSLANWLCLTKWESSYNTKATNYNPSSESTDYGIFQIN

LYSC_BOVIN - KVFERCELARTLKKLGLDGYKGVSLANWLCLTKWESSYNTKATNYNPSSESTDYGIFQIN
LYSC2_BOVIN - KVFERCELARTLKKLGLDGYKGVSLANWLCLTKWESSYNTKATNYNPSSESTDYGIFQIN

LYSC2_CAPHI - KVFERCELARTLKELGLDGYKGVSLANWLCLTKWESSYNTKATNYNPGSESTDYGIFQIN
LYSC1_SHEEP - KVFERCELARTLKELGLDGYKGVSLANWLCLTKWESSYNTKATNYNPGSESTDYGIFQIN

LYSC3_SHEEP - KVFERCELARTLKKLGLDDYKGVSLANWLCLSKWESGYNTKATNYNPGSESTDYGIFQIN
LYSC1_CAPHI - KVFERCELARTLKKLGLDDYKGVSLANWLCLTKWESGYNTKATNYNPGSESTDYGIFQIN

LYSC3_PIG - KVYDRCEFARILKKSGMDGYRGVSLANWVCLAKWESNFNTKATNYNPGSQSTDYGIFQIN
LYSC1_PIG - KVYDRCEFARILKKSGMDGYRGVSLANWVCLAKWESDFNTKAINRN--VGSTDYGIFQIN

LYSC2_PIG - KVYDRCEFARILKKSGMDGYRGVSLANWVCLAKWESDFNTKAINHN--VGSTDYGIFQIN
LYSCT_BOVIN - KTFKRCELAKTLKNLGLAGYKGVSLANWMCLAKGESNYNTQAKNYNPGSKSTDYGIFQIN

LYSC_CAMDR - KVWERCALARKLKELGMDGYRGVSLANWMCLTKWESDYNTDATNYNPSSESTDYGIFQIN
LYSC2_RAT - KVFKHCELARILRSSALAGYRGVSLENWMCMAQHESNFDTEAINYNSTDQSTDYGIFQIN

LYSC1_RAT - KIYERCQFARTLKRNGMSGYYGVSLADWVCLAQHESNYNTQARNYNPGDQSTDYGIFQIN
LYSCP_MOUSE - KVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRATNYNRGDRSTDYGIFQIN

LYSCM_MOUSE - KVYERCEFARTLKRNGMAGYYGVSLADWVCLAQHESNYNTRATNYNRGDQSTDYGIFQIN
LYSCN_BOVIN - KVFERCELARSLKRFGMDNFRGISLANWMCLARWESNYNTQATNYNAGDQSTDYGIFQIN

LYSCK_SHEEP - KVFERCELARTLKRFGMDGFRGISLANWMCLARWESSYNTQATNYNSGDRSTDYGIFQIN
LYSC_HYLLA - KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNPGDRSTDYGIFQIN

LYSC_GORGO - KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQIN
LYSC_PONPY - KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNPGDRSTDYGIFQIN

LYSC_COLAN - KIFERCELARTLKKLGLDGYKGVSLANWVCLAKWESGYNTDATNYNPGDESTDYGIFQIN
LYSC_NASLA - KIFERCELARTLKKLGLDGYKGVSLANWVCLAKWESGYNTEATNYNPGDESTDYGIFQIN

LYSC_PYGNE - KIFERCELARTLKKLGLDGYKGVSLANWVCLAKWESGYNTEATNYNPGDESTDYGIFQIN
LYSC_TRAFR - KIFERCELARTLKKLGLDGYKGVSLANWVCLAKWESGYNTEATNYNPGDESTDYGIFQIN

LYSC_CALJA - KVFERCELARTLKRFGLDGYRGISLANWMCLAKWESDYNTRATNYNPGDQSTDYGIFQIN
LYSC_SAGOE - KVFERCELARTLKRLGLDGYRGISLANWMCLAKWESDYNTRATNYNPGDQSTDYGIFQIN

LYSC_SAISC - KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESDYNTRATNYNPGDQSTDYGIFQIN
LYSC_MACMU - KIFERCELARTLKRLGLDGYRGISLANWVCLAKWESNYNTQATNYNPGDQSTDYGIFQIN

LYSC_CERTO - KIFERCELARTLKRLGLDGYRGISLANWVCLAKWESDYNTQATNYNPGDQSTDYGIFQIN
LYSC_CERAE - KIFERCELARTLKRLGLDGYRGISLANWVCLAKWESGYNTQATNYNPGDQSTDYGIFQIN

LYSC_MIOTA - KIFERCELARTLKRLGLDGYRGISLANWVCLAKWESDYNTQATNYNPGDQSTDYGIFQIN
LYSC_ALLNI - KIFERCELARTLKRLGLDGYRGISLANWVCLAKWESDYNTQATNYNPGDQSTDYGIFQIN

LYSC_RABIT - KIYERCELARTLKKLGLDGYKGVSLANWMCLAKWESSYNTRATNYNPGDKSTDYGIFQIN
LYSC2_CANFA - KIFERCELARTLKNLGLAGYKGVSLANWVCLAKWESNYNTRATNYNPGSKSTDYGIFQIN

LYSC_HALGR - KIFERCDLARTLKRLGLAGFKGVSLANWMCLAKWESNYNTKATNYNPGSRSTDYGIFQIN
LYSC_LEPWE - KVFERCDLARTLKRLGLAGFKGVSLANWMCLAKWESDYNTKATNYNPGSRSTDYGIFQIN

LYSC2_ONCMY - KVYDRCELARALKASGMDGYAGNSLPNWVCLSKWESSYNTQATNRNT-DGSTDYGIFQIN
LYSC_FUGRU - KVFQRCEWARVLKARGMDGYRGISLADWVCLSKWESQYNTNAINHNT-DGSTDYGIFQIN

LYSC_SCOMX - KVFERCEWARLLKRNGMSNYRGISLADWVCLSQWESSYNTRATNRNT-DGSTDYGIFQIN
LYSC_PAROL - RVYERCEWARLLRNQGMDGYRGISLANWVCLTEWESHYNTRATNHNT-DGSTDYGIFQIN
.....*.......................*....**........................


Part 1: 78 - 133:


LYSC_CHICK - SRWWCN-DGR---TPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRC

LYS1_MUSDO - NYYWCQ-PSN---GRFSYNECHLSCDALLTDNISNSVTCARKIKSQ-QGWTAWSTWK-YC
LYSX_DROME - DMYWCQ-PSS---GKFSHNGCDVSCNALLTDDIKSSVRCALKVLGQ-QGWSAWSTWH-YC

LYZL6_HUMAN - SHYWCN-DYK----SYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHC
LYZL6_MOUSE - SRYWCN-DYQ----SHSENFCHVDCQELLSPNLISTIHCAKKIVSGPGGMKNWVEWKLHC

LYZL4_HUMAN - GSDWCGDHGR--------NRCHMSCSALLNPNLEKTIKCAKTIVKGKEGMGAWPTWSRYC
LYZL4_MOUSE - DNEWCG-HGK--------NLCSVSCTALLNPNLKDTIQCAKKIVKGKHGMGAWPIWSKNC

LYS_ANOGA - NKYWCD-SGY------GSNDCKIACKNLLNDDITDDIKCAK-LIHKRHGFNAWYGWKNHC
LYS_GALME - DKYWCS-NTS---KAG--KDCNITCSQLLTDDITVASKCAKKVYKR-HNFMAWYGWRNHC

LYS_BOMMO - DRYWCS-KGA---SPG--KDCNVKCSDLLTDDITKAAKCAKKIYKR-HRFDAWYGWKNHC
LYS_HYACE - DKYWCS-KGT---TPG--KDCNVTCNQLLTDDISVAATCAKKIYKR-HKFDAWYGWKNHC

LYS_ANTMY - DKYWCS-KGS---TPG--KDCNVTCSQLLTDDITVASTCAKKIYKR-TKFDAWSGWDNHC
LYS_HYPCU - DKYWCS-NTR---TPG--KDCNVTCADLLLDDITKASTCAKKIFKR-HNFRAWYGWRNHC

LYS_TRINI - DKYWCS-KTS---TPG--KDCNVTCAEMLLDDITKASKCAKKIYKR-HKFQAWYGWRNHC
LYSC_COLLI - SKYWCN-DGK---TRGSKNACNINCSKLRDDNIADDIQCAKKIAREARGLTPWVAWKKYC

LYSC_OPIHO - SKYWCN-DGK---TSGAVDGCHISCSELMTNDLEDDIKCAKKIARDAHGLTPWYGWKNHC
LYZL1_MOUSE - SFTWCR-NAR----KHQKNHCHVACSALITDDLTDAILCAKKIVKETQGMNYWQGWKKNC

LYZL1_HUMAN - SFAWCR-RGK----LKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHC
LYZL2_HUMAN - SFAWCR-RGK----LKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHC

LYSC1_CANFA - SKWWCKSNSH-----SSANACNIMCSKFLDDNIDDDIACAKRVVKDPNGMSAWVAWVKHC
LYSC1_HORSE - NKWWCK-DNK----RSSSNACNIMCSKLLDENIDDDISCAKRVVRDPKGMSAWKAWVKHC

LYSC_EQUAS - SKWWCK-DNK----RSSSNACNIMCSKLLDDNIDDDISCAKRVVRDPKGMSAWKAWVKHC
LYSC_TRISI - SRWWCN-DGK---TPKAKNACGIECSELLKADITAAVNCAKRIVRDPNGMGAWVAWTKYC

LYSC_CRAFA - SRWWCN-DGK---TPGTRNLCHISCSALMGADIAPSVRCAKKIVSDGNGMNAWVAWRKHC
LYSC_ORTVE - SRWWCN-DGR---TPGTKNLCHISCSALMGADIAPSVRCAKRIVSDGDGMNAWVAWRKHC

LYSC1_ANAPL - SRWWCD-NGK---TPRSKNACGIPCSVLLRSDITEAVRCAKRIVSDGDGMNAWVAWRNRC
LYSC_AIXSP - SRWWCN-DGK---TPGAKNVCGIPCSVLLRSDITEAVKCAKRIVSDGNGMNAWVAWRNRC

LYSC3_ANAPL - SRWWCD-NGK---TPRAKNACGIPCSVLLRSDITEAVKCAKRIVSDGDGMNAWVAWRNRC
LYSC_PHACO - SRWWCN-DGR---TPGSKNLCHIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRKHC

LYSC_PHAVE - SRWWCN-DGR---TPGSKNLCHIPCSALLSSDITASVNCAKKIVSDGDGMNAWVAWRKHC
LYSC_NUMME - SRWWCN-DGR---TPGSRNLCNIPCSALQSSDITATANCAKKIVSDGNGMNAWVAWRKHC

LYSC_COTJA - SRWWCN-DGR---TPGSRNLCNIPCSALLSSDITASVNCAKKIVSDVHGMNAWVAWRNRC
LYSC_SYRSO - SRWWCN-DGR---TPGSRNLCNIPCSALLSSDTIASVNCAKKIVSDGNGMNAWVAWRKRC

LYSC_COLVI - SRWWCN-DGK---TPGSRNLCNIPCSALLSSDITATVNCAKKIVSDGNGMNAWVAWRNRC
LYSC_LOPCA - SRWWCN-DGR---TPGSRNLCNIPCSALLSSDITATVNCAKKIVSDGNGMNAWVAWRNRC

LYSC_LOPLE - SRWWCN-DGK---TPGSRNLCHIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRC
LYSC_CHRAM - SRWWCN-DGR---TPGSRNLCHIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRC

LYSC_SYRRE - SRWWCN-DGR---TPGSRNLCHISCSALLSSDITASVNCAKKIVSDRNGMNAWVAWRNRC
LYSC_MELGA - SRWWCN-DGR---TPGSKNLCNIPCSALLSSDITASVNCAKKIASGGNGMNAWVAWRNRC

LYSC_TRASA - SRWWCN-DGR---TPGSRNLCNIPCSALLSSDITASVNCAKKIVSGGSGMNAWVAWRNRC
LYSC_TRATE - SRWWCN-DGR---TPGSRNLCNIPCSALLSSDITASVNCAKKIVSGGNGMSAWVAWRNRC

LYSC_CATWA - SRWWCN-DGR---TPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRC
LYSC_PAVCR - SRWWCN-DGR---TPGSRNLCNIPCSALLSSDITASVNCAKKIVSDRNGMNAWVAWRNRC

LYSC_TRIVU - SHYWCD-DGK---TPHAANECKVRCSELQEDDLVKAVNCAKKIV-DQQGIRAWVAWRNKC
LYSC_AXIAX - SKWWCD-DGK---TPNAVDGCHVACSELMENNIDKAVTCAKQIVRE-QGITAWVAWKSHC

LYSC1_BOVIN - SKWWCN-DGK---TPNAVDGCHVSCSELMENDIAKAVACAKQIVSE-QGITAWVAWKSHC
LYSC3_BOVIN - SKWWCN-DGK---TPNAVDGCHVSCSELMENDIAKAVACAKHIVSE-QGITAWVAWKSHC

LYSC_BOVIN - SKWWCN-DGK---TPNAVDGCHVSCRELMENDIAKAVACAKHIVSE-QGITAWVAWKSHC
LYSC2_BOVIN - SKWWCN-DGK---TPNAVDGCHVSCSELMENDIAKAVACAKHIVSE-QGITAWVAWKSHC

LYSC2_CAPHI - SKFWCN-DGK---TPNAVDGCHVSCSELMENNIAKAVACAKQIVSE-QGITAWVAWKSHC
LYSC1_SHEEP - SKWWCN-DGK---TPNAVDGCHVSCSELMENNIAKAVACAKHIVSE-QGITAWVAWKSHC

LYSC3_SHEEP - SKWWCN-DGK---TPNAVDGCHVSCSALMENDIEKAVACAKHIVSE-QGITAWVAWKSHC
LYSC1_CAPHI - SKFWCN-DGK---TPDAVDGCHVSCSELMENDIEKAVACAKHIVSE-QGITAWVAWKSHC

LYSC3_PIG - SRYWCN-DGK---TPKAVNACHISCKVLLDDDLSQDIECAKRVVRDPQGIKAWVAWKAHC
LYSC1_PIG - SRYWCN-DGK---TPKAVNACHISCKVLLDDDLSQDIECAKRVVRDPQGIKAWVAWRTHC

LYSC2_PIG - SRYWCN-DGK---TPKAVNACHISCKVLLDDDLSQDIECAKRVVRDPLGVKAWVAWRAHC
LYSCT_BOVIN - SKWWCN-DGK---TPKAVNGCGVSCSALLKDDITQAVACAKKIVSQ-QGITAWVAWKNKC

LYSC_CAMDR - SRYWCN-NGK---TPHAVNGCGINCNVLLEDDITKAVQCAKRVVRDPQGVRAWVAWKNHC
LYSC2_RAT - SRYWCN-DGK---TPRAVNACGIPCSALLQDDITQAIQCAKRVVRDPQGIRAWVAWQRHC

LYSC1_RAT - SRYWCN-DGK---TPRAKNACGIPCSALLQDDITQAIQCAKRVVRDPQGIRAWVAWQRHC
LYSCP_MOUSE - SRYWCN-DGK---TPRSKNACGINCSALLQDDITAAIQCAKRVVRDPQGIRAWVAWRTQC

LYSCM_MOUSE - SRYWCN-DGK---TPRAVNACGINCSALLQDDITAAIQCAKRVVRDPQGIRAWVAWRAHC
LYSCN_BOVIN - SHWWCN-DGK---TPGAVNACHLPCGALLQDDITQAVACAKRVVSDPQGIRAWVAWRSHC

LYSCK_SHEEP - SHWWCN-DGK---TPGAVNACHIPCSALLQDDITQAVACAKRVVSDPQGIRAWVAWRSHC
LYSC_HYLLA - SRYWCN-DGK---TPGAVNACHLSCNALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRC

LYSC_GORGO - SRYWCN-DGK---TPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRC
LYSC_PONPY - SRYWCN-DGK---TPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRC

LYSC_COLAN - SRYWCN-NGK---TPGAVNACHISCNALLQNNIADAVACAKRVVSDPQGIRAWVAWKKHC
LYSC_NASLA - SRYWCN-NGK---TPGAVDACHISCSALLQNNIADAVACAKRVVSDPQGIRAWVAWRNHC

LYSC_PYGNE - SRYWCN-NGK---TPGAVDACHISCSALLQNNIADAVACAKRVVSDPQGVRAWVAWRNHC
LYSC_TRAFR - SRYWCN-NGK---TPGAVDACHISCSALLQNNIADAVACAKRVVSDPQGIRAWVAWRNHC

LYSC_CALJA - SHYWCN-NGR---TPGAVNACHISCNALLQDDITEAVACAKRVVRDPQGIRAWVAWKAHC
LYSC_SAGOE - SHYWCN-NGR---TPGAVNACHISCNALLQDDITEAVACAKRVVRDPQGIRAWVAWKAHC

LYSC_SAISC - SHYWCN-NGR---TPGAVNACHISCNALLQDDITQAVACAKRVVRDPQGIRAWVAWKAHC
LYSC_MACMU - SHYWCN-NGK---TPGAVNACHISCNALLQDNIADAVTCAKRVVSDPQGIRAWVAWRNHC

LYSC_CERTO - SHYWCN-NGK---TPGAVNACHISCNALLQDNIADAVTCAKRVVSDPQGIRAWVAWRNHC
LYSC_CERAE - SHYWCN-NGK---TPGAVNACHISCNALLQDNIADAVTCAKRVVRDPQGIRAWVAWRNHC

LYSC_MIOTA - SHYWCN-NGK---TPGAVNACHISCNALLQDNIADAVTCAKRVVRDPQGIRAWVAWRNHC
LYSC_ALLNI - SHYWCN-NGK---TPGAVNACRISCNALLQDNIADAVTCAKRVVRDPQGIRAWVAWRNHC

LYSC_RABIT - SRYWCN-DGK---TPRAVNACHIPCSDLLKDDITQAVACAKRVVSDPQGIRAWVAWRNHC
LYSC2_CANFA - SRYWCN-DGK---TPRAVNACHISCSALLQDDITQAVACAKRVVSDPNGIRAWVAWRAHC

LYSC_HALGR - SRYWCN-DGK---TPRAVNACHIPCSDLLKDDITQAVACAKRVVSDPNGIRAWVAWRAHC
LYSC_LEPWE - SRYWCN-DGK---TPRAVNSCHIPCSDLLKDDITQAVACAKRVVSDPNGIRAWVAWRAHC

LYSC2_ONCMY - SRYWCD-DGR---TPGAKNVCGIRCSQLLTADLTVAIRCAKRVVLDPNGIGAWVAWRLHC
LYSC_FUGRU - SRWWCN-DDR---IP-TRNACNIKCSALQTDDVTVAINCAKRVVSDPQGIRAWVAWNRHC

LYSC_SCOMX - SRWWCD-NGQ---TPTS-NACGISCSALLTDDVGAAIICAKHVVRDPNGIGAWVAWKRHC
LYSC_PAROL - SRWWCN-DSQ---TPTS-NACNIRCSELLTDDVIVAIKCAKRVVRDPNGIGAWVAWRQHC
....................*...*.............**............*..*...*


Part 1: 134 - 147:

LYSC_CHICK - -KGTDVQAWIRGCRL
LYS1_MUSDO - -SGS-----------
LYSX_DROME - -SG------------

LYZL6_HUMAN - -SGRPLFYWLTGCRL
LYZL6_MOUSE - -LGRPLSYWMTGCHL
LYZL4_HUMAN - QYSDTLARWLDGCKL
LYZL4_MOUSE - QLSDVLDRWLDGCDL
LYS_ANOGA - -NG------------

LYS_GALME - -Q-------------
LYS_BOMMO - -QGS-----------
LYS_HYACE - -Q-------------
LYS_ANTMY - ---------------
LYS_HYPCU - -DG------------

LYS_TRINI - -QGT-----------
LYSC_COLLI - -QGKDLSSYVRGC--
LYSC_OPIHO - -EGRDLSSYVKGC--
LYZL1_MOUSE - -ENKDMSEWKRGCEV
LYZL1_HUMAN - -EGRDLSEWKKGCEV
LYZL2_HUMAN - -EGRDLSDWKKDCEV
LYSC1_CANFA - -KGKDLSKYLASCNL
LYSC1_HORSE - -KDKDLSEYLASCNL
LYSC_EQUAS - -KDKDLSEYLASCNL
LYSC_TRISI - -KGKDVSQWIKGCKL
LYSC_CRAFA - -KGTDVSKWIKDCKL
LYSC_ORTVE - -KGTDVSTWIKDCKL
LYSC1_ANAPL - -RGTDVSKWIRGCRL
LYSC_AIXSP - -KGTDVSRWIRGCRL
LYSC3_ANAPL - -KGTDVSRWIRGCRL
LYSC_PHACO - -KGTDVNVWIRGCRL
LYSC_PHAVE - -KGTDVNVWIRGCRL
LYSC_NUMME - -KGTDVRVWIKGCRL
LYSC_COTJA - -KGTDVNAWIRGCRL
LYSC_SYRSO - -KGTDVNAWTRGCRL
LYSC_COLVI - -KGTDVQAWIRGCRL
LYSC_LOPCA - -KGTDVHAWIRGCRL
LYSC_LOPLE - -KGTDVSVWTRGCRL
LYSC_CHRAM - -KGTDVNAWTRGCRL
LYSC_SYRRE - -KGTDVNAWIRGCRL
LYSC_MELGA - -KGTDVHAWIRGCRL
LYSC_TRASA - -KGTDVQAWIRGCRL
LYSC_TRATE - -KGTDVHAWIRGCRL
LYSC_CATWA - -KGTDVHAWIRGCRL
LYSC_PAVCR - -KGTDVHAWIRGCRL
LYSC_TRIVU - -EGKDLSKYLEGCHL
LYSC_AXIAX - -RGHDVSSYVEGCTL
LYSC1_BOVIN - -RDHDVSSYVEGCTL
LYSC3_BOVIN - -RDHDVSSYVQGCTL
LYSC_BOVIN - -RDHDVSSYVEGCTL
LYSC2_BOVIN - -RDHDVSSYVEGCTL
LYSC2_CAPHI - -RDHDVSSYVEGCTL
LYSC1_SHEEP - -RDHDVSSYVEGCSL
LYSC3_SHEEP - -RVHDVSSYVEGCKL
LYSC1_CAPHI - -RDHDVSSYVEGCTL
LYSC3_PIG - -QNKDVSQYIRGCKL
LYSC1_PIG - -QNKDVSQYIRGCKL
LYSC2_PIG - -QNKDVSQYIRGCKL
LYSCT_BOVIN - -RNRDLTSYVKGC--
LYSC_CAMDR - -EGHDVEQYVEGCDL
LYSC2_RAT - -QNRDLSGYIRNC--
LYSC1_RAT - -KNRDLSGYIRNC--
LYSCP_MOUSE - -QNRDLSQYIRNC--
LYSCM_MOUSE - -QNRDLSQYIRNC--
LYSCN_BOVIN - -QNQDLTSYIQGC--
LYSCK_SHEEP - -QNQDLTSYIQGC--
LYSC_HYLLA - -QNRDLRQYIQGC--
LYSC_GORGO - -QNRDVRQYVQGC--
LYSC_PONPY - -QNRDVRQYVQGC--
LYSC_COLAN - -QNRDVSQYVEGC--
LYSC_NASLA - -QNRDVSQYVKGC--
LYSC_PYGNE - -QNKDVSQYVKGC--
LYSC_TRAFR - -QNKDVSQYVKGC--
LYSC_CALJA - -QNRDVSQYVQGC--
LYSC_SAGOE - -QNRDVSQYIQGC--
LYSC_SAISC - -QNRDVSQYVQGC--
LYSC_MACMU - -QNRDVSQYVQGC--
LYSC_CERTO - -QNRDVSQYVQGC--
LYSC_CERAE - -QNRDVSQYVQGC--
LYSC_MIOTA - -HNRDVSQYVQGC--
LYSC_ALLNI - -QNRDVSQYVQGC--
LYSC_RABIT - -QNQDLTPYIRGC--
LYSC2_CANFA - -ENRDVSQYVRNC--
LYSC_HALGR - -ENQDVSQYVRNC--
LYSC_LEPWE - -ENQDVSQYVRNC--
LYSC2_ONCMY - -QNQDLRSYVAGC--
LYSC_FUGRU - -QNRDLSAYIAGCGL
LYSC_SCOMX - -QGQDLSSYVAGC--
LYSC_PAROL - -QGQDLSSYLAGCGL
...............


Lysozyme CPK coloured by residue conservatism

All residues are coloured by they conservatism. From dark blue for variable residues through white for average variable residues to dark magenta for completely conserved residues. Please note that for this picture the orientation of the Lysozyme molecule is different form that used for all other pictures presented on this page.

News

Lysozome deficient cell has better immunity against Salmonella

By replacing one of the most important soldiers ...

Lysozyme Decrease Diseases Caused by Salmonella

When a hen lays an egg, it gives the egg some ...


Other news pages:
1


Copyright 2006-... by Lysozyme.co.uk